Primary structure of an alkaline ribonuclease from bovine liver. 1990

K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
Department of Microbiology, Hoshi College of Pharmacy, Tokyo.

A pyrimidine base specific and most basic alkaline RNase named RNase BL4 was isolated from bovine liver as a protein showing a single band on slab gel-electrophoresis. The enzyme is most active at pH 7.5. The enzyme was immunologically distinguishable from the known bovine RNases such as pancreatic RNase (RNase A), seminal RNase, kidney non-secretory RNase (RNase K2), and brain RNase (RNase BRb). The primary structure of this pyrimidine base-specific RNase was determined to be less than EDRMYQRFLRQHVDPDETG- GNDSYCNLMMQRRKMTSHQCKRFNTFIHEDLWNIRSICSTTNIQCKNGQMNCHEGVVRV- TDCRETGSSRAPNCRYRAKASTRRVVIACEGNPEVPVHFDK. It consists of 119 amino acid residues, and is 5 amino acid residues shorter than RNase A. The sequence homology of RNase BL4 with RNase A is 46.2%, and optimal alignment of RNase A and RNase BL4 requires five deletions, one at the 24th position, two at the 75th and 76th positions, and two at the C-terminus in RNase BL4. The RNase BL4 was highly homologous with a porcine liver RNase (RNase PL3, 94.1% homology) studied by Hofsteenge et al. (personal communication from Hofsteenge, J., Matthies, R., and Stones, S.R.).

UI MeSH Term Description Entries
D008099 Liver A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances. Livers
D008969 Molecular Sequence Data Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories. Sequence Data, Molecular,Molecular Sequencing Data,Data, Molecular Sequence,Data, Molecular Sequencing,Sequencing Data, Molecular
D002417 Cattle Domesticated bovine animals of the genus Bos, usually kept on a farm or ranch and used for the production of meat or dairy products or for heavy labor. Beef Cow,Bos grunniens,Bos indicus,Bos indicus Cattle,Bos taurus,Cow,Cow, Domestic,Dairy Cow,Holstein Cow,Indicine Cattle,Taurine Cattle,Taurus Cattle,Yak,Zebu,Beef Cows,Bos indicus Cattles,Cattle, Bos indicus,Cattle, Indicine,Cattle, Taurine,Cattle, Taurus,Cattles, Bos indicus,Cattles, Indicine,Cattles, Taurine,Cattles, Taurus,Cow, Beef,Cow, Dairy,Cow, Holstein,Cows,Dairy Cows,Domestic Cow,Domestic Cows,Indicine Cattles,Taurine Cattles,Taurus Cattles,Yaks,Zebus
D006868 Hydrolysis The process of cleaving a chemical compound by the addition of a molecule of water.
D000595 Amino Acid Sequence The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION. Protein Structure, Primary,Amino Acid Sequences,Sequence, Amino Acid,Sequences, Amino Acid,Primary Protein Structure,Primary Protein Structures,Protein Structures, Primary,Structure, Primary Protein,Structures, Primary Protein
D000818 Animals Unicellular or multicellular, heterotrophic organisms, that have sensation and the power of voluntary movement. Under the older five kingdom paradigm, Animalia was one of the kingdoms. Under the modern three domain model, Animalia represents one of the many groups in the domain EUKARYOTA. Animal,Metazoa,Animalia
D012260 Ribonucleases Enzymes that catalyze the hydrolysis of ester bonds within RNA. EC 3.1.-. Nucleases, RNA,RNase,Acid Ribonuclease,Alkaline Ribonuclease,Ribonuclease,RNA Nucleases,Ribonuclease, Acid,Ribonuclease, Alkaline
D013379 Substrate Specificity A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts. Specificities, Substrate,Specificity, Substrate,Substrate Specificities
D013552 Swine Any of various animals that constitute the family Suidae and comprise stout-bodied, short-legged omnivorous mammals with thick skin, usually covered with coarse bristles, a rather long mobile snout, and small tail. Included are the genera Babyrousa, Phacochoerus (wart hogs), and Sus, the latter containing the domestic pig (see SUS SCROFA). Phacochoerus,Pigs,Suidae,Warthogs,Wart Hogs,Hog, Wart,Hogs, Wart,Wart Hog

Related Publications

K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
December 1988, Journal of biochemistry,
K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
August 1988, Journal of biochemistry,
K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
January 1989, Ukrainskii biokhimicheskii zhurnal (1978),
K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
November 1989, Journal of biochemistry,
K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
December 1989, Biochemistry,
K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
September 1986, Bioorganicheskaia khimiia,
K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
November 1978, Biochimica et biophysica acta,
K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
February 1988, The Biochemical journal,
K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
November 1991, European journal of biochemistry,
K Hosoya, and Y Nagareda, and S Hasemi, and A Sanda, and Y Takizawa, and H Watanabe, and K Ohgi, and M Irie
December 1996, Bioscience, biotechnology, and biochemistry,
Copied contents to your clipboard!