Primary structure of a base non-specific ribonuclease from Rhizopus niveus. 1988

H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
Department of Agricultural Chemistry, University of Tokyo.

The primary structure of a base non-specific ribonuclease from Rhizopus niveus (RNase Rh) was determined by nucleotide sequence analysis of the DNA fragment encoding RNase Rh gene including signal peptide sequence, and amino acid sequence analysis of the peptide obtained from RNase Rh and RNase Rh' (a protease-modified RNase Rh created during the course of purification). The sequence determined was: MKAVLALATLIGSTLASSCSSTA LSCSNSANSDTCCSPEYGLVVLNMQWAPGYGPANAFTLHGLWPDKCSGAYAPSGGCDSN RASSSIASVIKSKDSSLYNSMLTYWPSNQGNNNVFWSHEWSKHGTCVSTYDPDCYDNYE EGEDIVDYFQKAMDLRSQYNVYKAFSSNGITPGGTYTATEMQSAIESYFGAKAKIDCSSG TLSDVALYFYVRGRDTYVITDALSTGSCSGDVEYPTK (the sequence of signal peptide is underlined). The sequence indicates that the homology with the sequence of RNase T2 from A. oryzae with the same base specificity is about 42% and that the sequences around the two histidine residues which are supposed to be involved in the active site are fairly conserved.

UI MeSH Term Description Entries
D008969 Molecular Sequence Data Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories. Sequence Data, Molecular,Molecular Sequencing Data,Data, Molecular Sequence,Data, Molecular Sequencing,Sequencing Data, Molecular
D002850 Chromatography, Gel Chromatography on non-ionic gels without regard to the mechanism of solute discrimination. Chromatography, Exclusion,Chromatography, Gel Permeation,Chromatography, Molecular Sieve,Gel Filtration,Gel Filtration Chromatography,Chromatography, Size Exclusion,Exclusion Chromatography,Gel Chromatography,Gel Permeation Chromatography,Molecular Sieve Chromatography,Chromatography, Gel Filtration,Exclusion Chromatography, Size,Filtration Chromatography, Gel,Filtration, Gel,Sieve Chromatography, Molecular,Size Exclusion Chromatography
D002851 Chromatography, High Pressure Liquid Liquid chromatographic techniques which feature high inlet pressures, high sensitivity, and high speed. Chromatography, High Performance Liquid,Chromatography, High Speed Liquid,Chromatography, Liquid, High Pressure,HPLC,High Performance Liquid Chromatography,High-Performance Liquid Chromatography,UPLC,Ultra Performance Liquid Chromatography,Chromatography, High-Performance Liquid,High-Performance Liquid Chromatographies,Liquid Chromatography, High-Performance
D003062 Codon A set of three nucleotides in a protein coding sequence that specifies individual amino acids or a termination signal (CODON, TERMINATOR). Most codons are universal, but some organisms do not produce the transfer RNAs (RNA, TRANSFER) complementary to all codons. These codons are referred to as unassigned codons (CODONS, NONSENSE). Codon, Sense,Sense Codon,Codons,Codons, Sense,Sense Codons
D003488 Cyanogen Bromide Cyanogen bromide (CNBr). A compound used in molecular biology to digest some proteins and as a coupling reagent for phosphoroamidate or pyrophosphate internucleotide bonds in DNA duplexes. Bromide, Cyanogen
D005591 Chemical Fractionation Separation of a mixture in successive stages, each stage removing from the mixture some proportion of one of the substances, for example by differential solubility in water-solvent mixtures. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed) Fractionation, Chemical,Chemical Fractionations,Fractionations, Chemical
D000595 Amino Acid Sequence The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION. Protein Structure, Primary,Amino Acid Sequences,Sequence, Amino Acid,Sequences, Amino Acid,Primary Protein Structure,Primary Protein Structures,Protein Structures, Primary,Structure, Primary Protein,Structures, Primary Protein
D000596 Amino Acids Organic compounds that generally contain an amino (-NH2) and a carboxyl (-COOH) group. Twenty alpha-amino acids are the subunits which are polymerized to form proteins. Amino Acid,Acid, Amino,Acids, Amino
D001483 Base Sequence The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence. DNA Sequence,Nucleotide Sequence,RNA Sequence,DNA Sequences,Base Sequences,Nucleotide Sequences,RNA Sequences,Sequence, Base,Sequence, DNA,Sequence, Nucleotide,Sequence, RNA,Sequences, Base,Sequences, DNA,Sequences, Nucleotide,Sequences, RNA
D012233 Rhizopus A genus of zygomycetous fungi of the family Mucoraceae, order MUCORALES, a common saprophyte and facultative parasite of mature fruits and vegetables. It may cause cerebral mycoses in diabetes and cutaneous infection in severely burned patients.

Related Publications

H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
June 1980, Canadian journal of biochemistry,
H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
January 1996, Journal of molecular biology,
H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
April 1989, Journal of molecular biology,
H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
July 1992, Journal of biochemistry,
H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
January 1998, Bioscience, biotechnology, and biochemistry,
H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
July 1992, FEBS letters,
H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
May 1997, Biological & pharmaceutical bulletin,
H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
August 1990, Journal of biochemistry,
H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
October 1998, Journal of biochemistry,
H Horiuchi, and K Yanai, and M Takagi, and K Yano, and E Wakabayashi, and A Sanda, and S Mine, and K Ohgi, and M Irie
October 2000, Bioscience, biotechnology, and biochemistry,
Copied contents to your clipboard!