BIOMAT Database Logo BIOMAT Database Logo

Characterization of vitelline membrane outer layer protein I, VMO-I: amino acid sequence and structural stability. 1995

S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
Department of Food Science, Kyoto Women's University.

Vitelline membrane outer layer protein I (VMO-I) tightly bound to ovomucin fibrils of hen's egg yolk membrane was characterized in terms of its amino acid sequence and structural stability. The deduced sequence of VMO-I using the conventional sequencing method is: RTREYTSVITVPNGGHWGKWGIRQFCHSGYANGFALKVEPSQFGRDDTALNGIRLRCLD- GSVIESLVGKWGTWTSFLVCPTGYLVSFSLRSEKSQGGGDDTAANNIQFRCSDEAVLVGD- DLSWGRFGPWSKRCKICGLQTKVESPQGLRDDTALNNVRFFCCK. Thus, VMO-I is composed of 163 amino acid residues with a calculated molecular weight of 17,979. The sequence confirms the cDNA sequence of VMO-I we recently determined and does not show any significant similarity to proteins compiled in the NBRF database. Two of the four disulfide bonds found in VMO-I were estimated to lie between Cys26 and Cys57 and between Cys79 and Cys110. The sequence analyses show that VMO-I contains three 53-residue internal repeats that contain distinctive regions of turns flanked by beta-sheets consistent with the recent finding that the molecule contains a new beta-fold motif, the beta-prism. The molecular characteristics of VMO-I in solution were examined by CD spectroscopy in the far and near ultraviolet regions, NMR spectroscopy, and high sensitive differential scanning calorimetry (DSC). CD spectra in the far UV region at room temperature were similar to that assigned to a random coil, while in the near UV region, small positive peaks were observed. The ellipticity in both regions decreased on raising the temperature. Proton NMR experiments showed the native structure unfolds to unordered conformations at 70 degrees C.(ABSTRACT TRUNCATED AT 250 WORDS)

UI MeSH Term Description Entries
D007526 Isoelectric Point The pH in solutions of proteins and related compounds at which the dipolar ions are at a maximum. Isoelectric Points,Point, Isoelectric,Points, Isoelectric
D008969 Molecular Sequence Data Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories. Sequence Data, Molecular,Molecular Sequencing Data,Data, Molecular Sequence,Data, Molecular Sequencing,Sequencing Data, Molecular
D009113 Muramidase A basic enzyme that is present in saliva, tears, egg white, and many animal fluids. It functions as an antibacterial agent. The enzyme catalyzes the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrin. EC 3.2.1.17. Lysozyme,Leftose,N-Acetylmuramide Glycanhydrolase,Glycanhydrolase, N-Acetylmuramide,N Acetylmuramide Glycanhydrolase
D009682 Magnetic Resonance Spectroscopy Spectroscopic method of measuring the magnetic moment of elementary particles such as atomic nuclei, protons or electrons. It is employed in clinical applications such as NMR Tomography (MAGNETIC RESONANCE IMAGING). In Vivo NMR Spectroscopy,MR Spectroscopy,Magnetic Resonance,NMR Spectroscopy,NMR Spectroscopy, In Vivo,Nuclear Magnetic Resonance,Spectroscopy, Magnetic Resonance,Spectroscopy, NMR,Spectroscopy, Nuclear Magnetic Resonance,Magnetic Resonance Spectroscopies,Magnetic Resonance, Nuclear,NMR Spectroscopies,Resonance Spectroscopy, Magnetic,Resonance, Magnetic,Resonance, Nuclear Magnetic,Spectroscopies, NMR,Spectroscopy, MR
D010450 Endopeptidases A subclass of PEPTIDE HYDROLASES that catalyze the internal cleavage of PEPTIDES or PROTEINS. Endopeptidase,Peptide Peptidohydrolases
D011487 Protein Conformation The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain). Conformation, Protein,Conformations, Protein,Protein Conformations
D002152 Calorimetry, Differential Scanning Differential thermal analysis in which the sample compartment of the apparatus is a differential calorimeter, allowing an exact measure of the heat of transition independent of the specific heat, thermal conductivity, and other variables of the sample. Differential Thermal Analysis, Calorimetric,Calorimetric Differential Thermal Analysis,Differential Scanning Calorimetry,Scanning Calorimetry, Differential
D002645 Chickens Common name for the species Gallus gallus, the domestic fowl, in the family Phasianidae, order GALLIFORMES. It is descended from the red jungle fowl of SOUTHEAST ASIA. Gallus gallus,Gallus domesticus,Gallus gallus domesticus,Chicken
D002942 Circular Dichroism A change from planar to elliptic polarization when an initially plane-polarized light wave traverses an optically active medium. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed) Circular Dichroism, Vibrational,Dichroism, Circular,Vibrational Circular Dichroism
D004220 Disulfides Chemical groups containing the covalent disulfide bonds -S-S-. The sulfur atoms can be bound to inorganic or organic moieties. Disulfide

Related Publications

S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
Characterization and miRNA-mediated posttranscriptional regulation of vitelline membrane outer layer protein I in the adult chicken oviduct.
March 2015, In vitro cellular & developmental biology. Animal,
S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
Destabilization of vitelline membrane outer layer protein 1 homolog (VMO1) by C-mannosylation.
March 2023, FEBS open bio,
S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
Amino acid sequence of an egg-lysin protein from abalone spermatozoa that solubilizes the vitelline layer.
August 1985, The Journal of biological chemistry,
S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
Proteins of the outer layer of the vitelline membrane of hen's eggs.
July 1982, Biochimica et biophysica acta,
S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
The complete amino acid sequence of vitelline coat lysin.
February 1986, European journal of biochemistry,
S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
Peptide mapping and amino acid sequence analysis of the 40 kDa outer membrane protein of Fusobacterium nucleatum.
January 1995, Advances in experimental medicine and biology,
S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
Amino acid sequence of the signal peptide of ompA protein, a major outer membrane protein of Escherichia coli.
January 1980, The Journal of biological chemistry,
S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
Amino acid sequence of the signal peptide of OmpF, a major outer membrane protein of Escherichia coli.
January 1982, FEBS letters,
S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
A plant outer mitochondrial membrane protein with high amino acid sequence identity to a chloroplast protein import receptor.
January 2004, FEBS letters,
S Kido, and Y Doi, and F Kim, and E Morishita, and H Narita, and S Kanaya, and T Ohkubo, and K Nishikawa, and T Yao, and T Ooi
Molecular cloning and characterization of the structural gene for protein I, the major outer membrane protein of Neisseria gonorrhoeae.
December 1987, Proceedings of the National Academy of Sciences of the United States of America,
Copied contents to your clipboard!