-transparent.png){kind=logo}
A serine proteinase from Penicillium citrinum was purified. The M(r) and isoelectric point were determined as about 26,000 and 9.5, respectively. Activity was retained up to above 40 degrees at pH 7 for 30 min, but the enzyme was completely inactivated at 50 degrees. The first amino acids in the N-terminal region were ANVVQSNVPSWGLARISSKRPGTTSYTYDSTAGEGVVFYGVDTG. The specificity differs from that of other serine proteinases. Kinetic studies on fluorogenic substrates were determined.
Related Publications
N Yamamoto, and
K Matsumoto, and
Y Yamagata, and
K Hirano, and
E Ichishima
April 1994,
Bioscience, biotechnology, and biochemistry,
N Yamamoto, and
K Matsumoto, and
Y Yamagata, and
K Hirano, and
E Ichishima
May 1998,
International archives of allergy and immunology,
N Yamamoto, and
K Matsumoto, and
Y Yamagata, and
K Hirano, and
E Ichishima
August 1990,
International journal of peptide and protein research,
N Yamamoto, and
K Matsumoto, and
Y Yamagata, and
K Hirano, and
E Ichishima
October 1994,
Applied biochemistry and biotechnology,
N Yamamoto, and
K Matsumoto, and
Y Yamagata, and
K Hirano, and
E Ichishima
June 2000,
Die Pharmazie,
N Yamamoto, and
K Matsumoto, and
Y Yamagata, and
K Hirano, and
E Ichishima
October 2013,
Natural product communications,
N Yamamoto, and
K Matsumoto, and
Y Yamagata, and
K Hirano, and
E Ichishima
October 2016,
Marine drugs,
N Yamamoto, and
K Matsumoto, and
Y Yamagata, and
K Hirano, and
E Ichishima
October 2010,
Indian journal of microbiology,
N Yamamoto, and
K Matsumoto, and
Y Yamagata, and
K Hirano, and
E Ichishima
February 2016,
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association,
N Yamamoto, and
K Matsumoto, and
Y Yamagata, and
K Hirano, and
E Ichishima
September 1991,
European journal of biochemistry,
