BIOMAT Database Logo BIOMAT Database Logo

Isolation and identification of a cAMP generating peptide from the flesh fly, Neobellieria bullata (Diptera: Sarcophagidae). 1996

K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
Zoologisch Institut, Katholieke Universiteit Leuven, Belgium.

The Manduca sexta Malpighian tubule assay system, developed to monitor adenylate cyclase activity, was used in combination with HPLC to isolate a novel cAMP generating peptide from 350,000 whole flesh flies, Neobellieria bullata. Mass spectrometry revealed a molecular mass of 5,047 daltons, and Edman degradation the following sequence: AGAEAEKLSGLSKYFNGTTMAGRANVAKATYAVIGLIIAYNVMKPKKK. This 48-mer peptide, called Neb-cGP, does not belong to the corticotropin releasing factor family of insect diuretic peptides. Electrophoresis and subsequent immunoblotting of peptides immunoprecipitated from a homogenate of entire flies showed that one fly contained approximately 0.003 to 0.03 micrograms Neb-cGP and that 10 micrograms represents the lowest immunostainable amount on a Western blot.

UI MeSH Term Description Entries
D008297 Male Males
D008317 Malpighian Tubules Slender tubular or hairlike excretory structures found in insects. They emerge from the alimentary canal between the mesenteron (midgut) and the proctodeum (hindgut). Malpighian Tubule,Tubule, Malpighian,Tubules, Malpighian
D008969 Molecular Sequence Data Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories. Sequence Data, Molecular,Molecular Sequencing Data,Data, Molecular Sequence,Data, Molecular Sequencing,Sequencing Data, Molecular
D008970 Molecular Weight The sum of the weight of all the atoms in a molecule. Molecular Weights,Weight, Molecular,Weights, Molecular
D011506 Proteins Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein. Gene Products, Protein,Gene Proteins,Protein,Protein Gene Products,Proteins, Gene
D002851 Chromatography, High Pressure Liquid Liquid chromatographic techniques which feature high inlet pressures, high sensitivity, and high speed. Chromatography, High Performance Liquid,Chromatography, High Speed Liquid,Chromatography, Liquid, High Pressure,HPLC,High Performance Liquid Chromatography,High-Performance Liquid Chromatography,UPLC,Ultra Performance Liquid Chromatography,Chromatography, High-Performance Liquid,High-Performance Liquid Chromatographies,Liquid Chromatography, High-Performance
D004175 Diptera An order of the class Insecta. Wings, when present, number two and distinguish Diptera from other so-called flies, while the halteres, or reduced hindwings, separate Diptera from other insects with one pair of wings. The order includes the families Calliphoridae, Oestridae, Phoridae, SARCOPHAGIDAE, Scatophagidae, Sciaridae, SIMULIIDAE, Tabanidae, Therevidae, Trypetidae, CERATOPOGONIDAE; CHIRONOMIDAE; CULICIDAE; DROSOPHILIDAE; GLOSSINIDAE; MUSCIDAE; TEPHRITIDAE; and PSYCHODIDAE. The larval form of Diptera species are called maggots (see LARVA). Flies, True,Flies,Dipteras,Fly,Fly, True,True Flies,True Fly
D004591 Electrophoresis, Polyacrylamide Gel Electrophoresis in which a polyacrylamide gel is used as the diffusion medium. Polyacrylamide Gel Electrophoresis,SDS-PAGE,Sodium Dodecyl Sulfate-PAGE,Gel Electrophoresis, Polyacrylamide,SDS PAGE,Sodium Dodecyl Sulfate PAGE,Sodium Dodecyl Sulfate-PAGEs
D005260 Female Females
D000242 Cyclic AMP An adenine nucleotide containing one phosphate group which is esterified to both the 3'- and 5'-positions of the sugar moiety. It is a second messenger and a key intracellular regulator, functioning as a mediator of activity for a number of hormones, including epinephrine, glucagon, and ACTH. Adenosine Cyclic 3',5'-Monophosphate,Adenosine Cyclic 3,5 Monophosphate,Adenosine Cyclic Monophosphate,Adenosine Cyclic-3',5'-Monophosphate,Cyclic AMP, (R)-Isomer,Cyclic AMP, Disodium Salt,Cyclic AMP, Monoammonium Salt,Cyclic AMP, Monopotassium Salt,Cyclic AMP, Monosodium Salt,Cyclic AMP, Sodium Salt,3',5'-Monophosphate, Adenosine Cyclic,AMP, Cyclic,Adenosine Cyclic 3',5' Monophosphate,Cyclic 3',5'-Monophosphate, Adenosine,Cyclic Monophosphate, Adenosine,Cyclic-3',5'-Monophosphate, Adenosine,Monophosphate, Adenosine Cyclic

Related Publications

K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
Resistance reflex that maintains upright head posture in the flesh fly neobellieria bullata (Sarcophagidae)
October 1998, The Journal of experimental biology,
K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
Neuropeptidomics of the grey flesh fly, Neobellieria bullata.
April 2004, Biochemical and biophysical research communications,
K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
Foraging by food deprived larvae of Neobellieria bullata (Diptera: Sarcophagidae).
January 1997, Journal of forensic sciences,
K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
Study of oostatic peptide uptake and metabolism in developing ovaries of the flesh fly, Neobellieria bullata.
January 2010, Journal of insect science (Online),
K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
Eicosanoids mediate the laminarin-induced nodulation response in larvae of the flesh fly, Neobellieria bullata.
May 2005, Archives of insect biochemistry and physiology,
K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
A phylotranscriptomic framework for flesh fly evolution (Diptera, Calyptratae, Sarcophagidae).
October 2021, Cladistics : the international journal of the Willi Hennig Society,
K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
Representation of the brain's superior protocerebrum of the flesh fly, Neobellieria bullata, in the central body.
October 2012, The Journal of comparative neurology,
K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
Preparation of tritiated oostatic peptides for study of radioactivity incorporation in flesh fly Neobellieria bullata.
September 2007, Amino acids,
K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
Ultramorphology of eggshell of flesh fly Liosarcophaga dux (Diptera: Sarcophagidae).
January 2005, Journal of medical entomology,
K Spittaels, and B Devreese, and L Schoofs, and H Neven, and I Janssen, and L Grauwels, and J Van Beeumen, and A De Loof
Comparison of the effects of pyrokinins and related peptides identified from arthropods on pupariation behaviour in flesh fly (Sarcophaga bullata) larvae (Diptera: Sarcophagidae).
January 2004, Journal of insect physiology,
Copied contents to your clipboard!